Machine Learning and Neural Networks group

Dipartimento di Ingegneria dell'Informazione
Università di Firenze
Via Santa Marta 3
50139 Firenze - Italy


DISULFIND

Cysteines Disulfide Bonding State and Connectivity Predictor


Results for 5oIJ1z
                  +------------------------------+                                      
                  |                              |                                      
         .........10........20........30........40........50........60........70........
AA       KLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVL
DB_state          1                              1                                      
DB_conf           5                              5                                      

                                  +---------------+                  
                                  |               |                  
         80........90........100.......110.......120.......130.......
AA       KTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGG
DB_state                          1               1                  
DB_conf                           6               5                  

DB_bond   bond(10,41)
DB_bond   bond(105,121)

Conn_conf 0.749646
  • Please cite:
    • A. Ceroni, A. Passerini, A. Vullo and P. Frasconi. DISULFIND: a Disulfide Bonding State and Cysteine Connectivity Prediction Server, Nucleic Acids Research, 34(Web Server issue):W177--W181, 2006.
  • Contact information:
  • Abbreviations used:
    • AA amino acid sequence
    • DB_state predicted disulfide bonding state (1=disulfide bonded, 0=not disulfide bonded)
    • DB_conf confidence of disulfide bonding state prediction (0=low to 9=high)
      A red colour means that the viterbi aligner overruled the most likely predition for that residue in order to achieve a consistent prediction at a protein level (even number of disulfide bonded cysteines, as interchain bonds are ignored). See papers for details.
    • DB_bond position in sequence of a pair of cysteines predicted to be forming a disulfide bridge.
    • Conn_conf confidence of connectivity assignment given the predicted disulfide bonding state (real value in [0,1])


home

top

© 2003-2006 Machine Learning and Neural Networks Group.
For questions and comments: disulfind at ai dot dinfo dot unifi dot it.